PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462942344
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MYB_related
Protein Properties Length: 199aa    MW: 21992.1 Da    PI: 8.7266
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462942344genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72e-162771147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT++E+e++v+a   +G + WktI + +g ++t+ q++s+ qky
        462942344 27 REKWTADEHERFVHALLVFGRD-WKTIEQFVG-TKTATQIRSHAQKY 71
                     789*****************77.*********.*************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.87E-162176IPR009057Homeodomain-like
PROSITE profilePS5129417.6632276IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.6E-92577IPR009057Homeodomain-like
SMARTSM007178.7E-102674IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.4E-162674IPR006447Myb domain, plants
PfamPF002494.5E-132771IPR001005SANT/Myb domain
CDDcd001672.07E-82972No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 199 aa     Download sequence    Send to blast
MSARNAMGTP ALGTKKPRKA YTISRPREKW TADEHERFVH ALLVFGRDWK TIEQFVGTKT  60
ATQIRSHAQK YFLKVHKQGL ATALPPPHPR RAAVLAAAGA PLTERRSNEA PVGGASPSEE  120
VAWLADALLD QEKTVQLPLS PDDVRFAEVY RFVGDVFGSA APWPVEAQLQ RLHGMDPVVA  180
ETILLGIEEF SCVRDEARC
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001142828.13e-62putative MYB DNA-binding domain superfamily protein
TrEMBLB6SQ503e-62B6SQ50_MAIZE; MYB-related transcription factor
STRINGGRMZM2G115070_P019e-62(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP36423170
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02840.33e-26LHY/CCA1-like 1